RetrogeneDB ID: | retro_mmul_2125 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 7:5878018..5878386(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2525 | ||
| Ensembl ID: | ENSMMUG00000019203 | ||
| Aliases: | TVP23B, FAM18B, FAM18B1 | ||
| Description: | None |
| Percent Identity: | 70.87 % |
| Parental protein coverage: | 67.74 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MLQQDSNDDTEDVSLFDAEEETTNRPRKSKIRHPVASFFHLFFRVSAIVVYLLCELLSSSFITCMVTIIL |
| ML.QDSNDDTED.S..DAEE.TTN....SKIR.P.AS.F.LFFRVSA.VV.LLC.L.SSSF..CMVTII. | |
| Retrocopy | MLHQDSNDDTEDISMLDAEE-TTNKTKQSKIRYPAASLFQLFFRVSAVVVSLLCKLVSSSFTACMVTII- |
| Parental | LLSCDFWAVKNVTGRLMVGLRWWNHI-DEDGKSHWVFESRKESSQENKTVSEAESRI |
| .LSCDF.AV.NVTG.L.VGL..WNH..DEDGKSHWV.ESRK..S.E..TVSEAES.. | |
| Retrocopy | -LSCDFRAVMNVTGGLVVGLWCWNHV<DEDGKSHWVLESRKAYSREDETVSEAESNL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 21 .51 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 15 .39 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 26 .93 RPM |
| SRP007412_heart | 0 .00 RPM | 14 .31 RPM |
| SRP007412_kidney | 0 .00 RPM | 20 .77 RPM |
| SRP007412_liver | 0 .00 RPM | 12 .23 RPM |
| SRP007412_testis | 0 .00 RPM | 22 .39 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_996 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000005330 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007609 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000003854 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000015098 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002825 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019203 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014658 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000000498 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012225 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050649 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000642 | 6 retrocopies | |
| Tarsius syrichta | ENSTSYG00000008082 | 2 retrocopies |