RetrogeneDB ID: | retro_mmul_1299 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 17:66455806..66456247(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MOB1A | ||
| Ensembl ID: | ENSMMUG00000015208 | ||
| Aliases: | None | ||
| Description: | MOB kinase activator 1A [Source:HGNC Symbol;Acc:16015] |
| Percent Identity: | 56.21 % |
| Parental protein coverage: | 69.63 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | NQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDY-LMTWVQDQLDDETLFPS |
| N.....Y....E...EASCPVMSA.P.Y.Y..A...NIKK.IK....K...Y.LMT.V..Q.DD.T.FPS | |
| Retrocopy | NSVDFFYQNTKELSSEASCPVMSAYPKYKYYLAGDINIKKLIKYTVLKCVHY>LMTLVLNQPDD-THFPS |
| Parental | KIGVP-FPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQ-EEAHLNTSF-KHFIFFVQEFNLIDRREL |
| KI.VP.FP.........ILK.LF.VY..IY.QH.DSVMQ...EEAHL.T...KH.IFFV.E.NLID..EL | |
| Retrocopy | KITVP>FPISLQQ-SLFILKCLFTVYTCIYQQHIDSVMQKE<EEAHLDTFL<KHLIFFV*ELNLIDKDEL |
| Parental | APLQELIEKLGSK |
| .PL.ELIEKLG.K | |
| Retrocopy | TPL*ELIEKLGTK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 7 .62 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .97 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .53 RPM |
| SRP007412_heart | 0 .00 RPM | 8 .24 RPM |
| SRP007412_kidney | 0 .00 RPM | 25 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .62 RPM |
| SRP007412_testis | 0 .11 RPM | 16 .85 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1223 |
| Pan troglodytes | retro_ptro_837 |
| Gorilla gorilla | retro_ggor_954 |
| Pongo abelii | retro_pabe_1017 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017359 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000008735 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007277 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000012838 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000018245 | 1 retrocopy | |
| Homo sapiens | ENSG00000114978 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010015 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000014338 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000015208 | 2 retrocopies |
retro_mmul_1299 , retro_mmul_297,
|
| Mustela putorius furo | ENSMPUG00000007824 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000321 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003504 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012284 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000012079 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042657 | 2 retrocopies |