RetrogeneDB ID: | retro_meug_524 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold131109:5828..6032(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMEUG00000012358 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 80.0 % |
| Parental protein coverage: | 69.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MNLERVSNEEKLNLCRKYYLGGFALLPFLWLVNVLWFFREAFLAPAYEEQGQIKGYVWRSALGLVFWLVV |
| MNLERVSNEE.L.LC.KYYLGGFALLPFLWLVNVLWFFREAFLA.AYEEQGQIKG.VW.....L..W..V | |
| Retrocopy | MNLERVSNEEQLDLCQKYYLGGFALLPFLWLVNVLWFFREAFLALAYEEQGQIKGCVW--LVVLTSWITV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Erinaceus europaeus | ENSEEUG00000002930 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012358 | 1 retrocopy |
retro_meug_524 ,
|
| Myotis lucifugus | ENSMLUG00000011528 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000036835 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000002056 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000024330 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001589 | 1 retrocopy |