RetrogeneDB ID: | retro_mdom_1920 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 8:144168024..144168276(-) | ||
| Located in intron of: | ENSMODG00000016983 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POLE3 | ||
| Ensembl ID: | ENSMODG00000004358 | ||
| Aliases: | None | ||
| Description: | polymerase (DNA directed), epsilon 3, accessory subunit [Source:HGNC Symbol;Acc:13546] |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 57.53 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNAGDVL |
| M.ERPE.LNL.N.VI.R..K..LP.GVNISK...S.IS.A....V....SCAN.F..KG..KT...GD.L | |
| Retrocopy | MEERPEGLNLLNDVIIRMVK*VLPEGVNISKGDQSTISEATTMLVWCTMSCANIFEVKGNWKTIYTGDIL |
| Parental | SAMEEMEFQRFISP |
| .AMEE.EFQ.F.SP | |
| Retrocopy | LAMEEQEFQGFLSP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 107 .16 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 49 .29 RPM |
| SRP007412_heart | 0 .00 RPM | 18 .34 RPM |
| SRP007412_kidney | 0 .00 RPM | 71 .11 RPM |
| SRP007412_liver | 0 .00 RPM | 31 .22 RPM |
| SRP007412_testis | 0 .00 RPM | 344 .54 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000017917 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000000313 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000003073 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000004358 | 3 retrocopies |
retro_mdom_1680, retro_mdom_1920 , retro_mdom_647,
|
| Mus musculus | ENSMUSG00000028394 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000004717 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000015392 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027365 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005211 | 1 retrocopy |