RetrogeneDB ID: | retro_mdom_1124 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:166728868..166729117(-) | ||
| Located in intron of: | ENSMODG00000007376 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CHCHD7 | ||
| Ensembl ID: | ENSMODG00000024930 | ||
| Aliases: | None | ||
| Description: | coiled-coil-helix-coiled-coil-helix domain containing 7 [Source:HGNC Symbol;Acc:28314] |
| Percent Identity: | 95.18 % |
| Parental protein coverage: | 86.46 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | IVTKRLRDPDVNPCLSESDASTRCMDENNYDREMCTTCFLKYKNCRKFWNAIMIERRRNGVKPHMPTAAE |
| IVTKRLRDPDVNPCL.ESDASTRCMDENNY.REMCTTCFLKYKNCRKFWNAIMIERRRN.VKPHMPTAAE | |
| Retrocopy | IVTKRLRDPDVNPCLLESDASTRCMDENNYIREMCTTCFLKYKNCRKFWNAIMIERRRNEVKPHMPTAAE |
| Parental | REKILGAMGKMPY |
| REKILG.MGKMPY | |
| Retrocopy | REKILGEMGKMPY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000007055 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000020301 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000024930 | 1 retrocopy |
retro_mdom_1124 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000002724 | 1 retrocopy |