RetrogeneDB ID: | retro_cfam_1197 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 26:22740810..22741057(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CHCHD7 | ||
| Ensembl ID: | ENSCAFG00000007055 | ||
| Aliases: | None | ||
| Description: | coiled-coil-helix-coiled-coil-helix domain containing 7 [Source:HGNC Symbol;Acc:28314] |
Retrocopy-Parental alignment summary:
>retro_cfam_1197
ATGCCCAAGGTAGCATGGAGGCTGAGAGAACATGACACAAATCCTTGCTTGTTGGAATCTGATGTTTCTACCAGAGGTAG
GGATGAAAATAACTATGACAGGGAGAGGTGGTCCACTTACTTCTTAAACTACAAAAGCTGCCAGAAATTCTGGAATTCTA
TCATGGGTCCAGAGAAGACAGAATGGAGTAAAGTCATCTATGCCTACAGCAGGAGAAAGAGATGAGATTCTTGGGGGTAA
CGGGAAA
ORF - retro_cfam_1197 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 77.11 % |
| Parental protein coverage: | 96.47 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | MPMVARRLRDPDINPCLLESDASTRCMDENNYDRERCSTYFLKYKNCRKFWNSVM-VQRRQKGVKPSMPT |
| MP.VA.RLR..D.NPCLLESD.STR..DENNYDRER.STYFL.YK.C.KFWNS.M.VQRRQ.GVK.SMPT | |
| Retrocopy | MPKVAWRLREHDTNPCLLESDVSTRGRDENNYDRERWSTYFLNYKSCQKFWNSIM>VQRRQNGVKSSMPT |
| Parental | AAERDEILGAMGK |
| A.ERDEILG..GK | |
| Retrocopy | AGERDEILGGNGK |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 15 .50 RPM |
| SRP017611_brain | 0 .00 RPM | 11 .04 RPM |
| SRP017611_kidney | 0 .00 RPM | 17 .83 RPM |
| SRP017611_liver | 0 .00 RPM | 4 .28 RPM |
Canis familiaris was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_cfam_1197 retrocopy.
Canis familiaris was not studied using FANTOM5 data.
retro_cfam_1197 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_cfam_1197 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 4 parental genes, and 5 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000007055 | 1 retrocopy |
retro_cfam_1197 ,
|
| Echinops telfairi | ENSETEG00000020301 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000024930 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002724 | 1 retrocopy |