RetrogeneDB ID: | retro_etel_888 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_180291:1301..1525(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSETEG00000010426 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSETEG00000020301 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 85.39 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KTASMPMVTRRLRDPDI-NPCLSESDLSTRCLDENNYNRERCSAYFLKYKNCRRFWNSILVERRQKGVKP |
| K.ASMP.VTRRLRDPD...PCLSESD.STRC..ENNY.RERCS.YFLKYKN.R..WNS..V...Q.G.KP | |
| Retrocopy | KIASMPTVTRRLRDPDM<DPCLSESDSSTRCRGENNYGRERCSPYFLKYKN-REVWNSVMVQKQQNGSKP |
| Parental | PMPTASE |
| P.PTA.E | |
| Retrocopy | PIPTAAE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000007055 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000020301 | 2 retrocopies |
retro_etel_1330, retro_etel_888 ,
|
| Monodelphis domestica | ENSMODG00000024930 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002724 | 1 retrocopy |