RetrogeneDB ID: | retro_itri_278 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393281.1:33502703..33502906(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CHCHD7 | ||
| Ensembl ID: | ENSSTOG00000002724 | ||
| Aliases: | None | ||
| Description: | coiled-coil-helix-coiled-coil-helix domain containing 7 [Source:HGNC Symbol;Acc:28314] |
| Percent Identity: | 56.52 % |
| Parental protein coverage: | 78.82 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MPVVTHRLRDPDI-NPCLLESDASRRCMDENNYDKERCSSYFLKYK-NCRRFWNSIMIQRRQNGVTPSM |
| MP.V...LRD.DI..PCL.ES.....C.DE.NYD.ERCS..F...K.N..RFWNS.M.Q.RQNG..PS. | |
| Retrocopy | MPEVKWKLRDSDI>SPCLPESNTPTKCTDEKNYDRERCSTVFSTFK>NYPRFWNSVMGQKRQNGAKPSV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000007055 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000020301 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000024930 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002724 | 1 retrocopy |
retro_itri_278 ,
|