RetrogeneDB ID: | retro_ggor_830 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 12:101282789..101283136(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NENF | ||
| Ensembl ID: | ENSGGOG00000025197 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.78 % |
| Parental protein coverage: | 67.43 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EEEDQPIYLAVKGVVFDVTSGKVFYFSRGFFPFKPIQGLNNSNSKAGISSNCAQHQTDIE-TGLTAKELE |
| .E.DQPIYLAVKGV..DVTSGK.FY..R...P.............A..S........D...TGL.AK.L. | |
| Retrocopy | QEKDQPIYLAVKGVGLDVTSGKGFYGQRA--PYNALTRKDSARGVAKVSLDHVDLTCDTP<TGLIAKKL* |
| Parental | ALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF |
| ..D.VFT.VYKAK.PIV.Y.A..ILNE.GSPNLDFK.EDQP..D.K..F | |
| Retrocopy | SMDDVFTSVYKAKHPIVSYRAQTILNEFGSPNLDFKTEDQPLSDKKEGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 12 .18 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 15 .13 RPM |
| SRP007412_heart | 0 .00 RPM | 17 .04 RPM |
| SRP007412_kidney | 0 .00 RPM | 23 .84 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .33 RPM |
| SRP007412_testis | 0 .00 RPM | 7 .15 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001341 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000000759 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000003399 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031796 | 1 retrocopy | |
| Homo sapiens | ENSG00000117691 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025197 | 1 retrocopy |
retro_ggor_830 ,
|
| Macaca mulatta | ENSMMUG00000002142 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000037499 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002893 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000014204 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000000236 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000001961 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015597 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000022293 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001880 | 3 retrocopies |