RetrogeneDB ID: | retro_btau_1238 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 3:100068431..100068749(+) | ||
| Located in intron of: | ENSBTAG00000000094 | ||
Retrocopy information | Ensembl ID: | ENSBTAG00000048006 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NENF | ||
| Ensembl ID: | ENSBTAG00000000759 | ||
| Aliases: | None | ||
| Description: | Neudesin [Source:UniProtKB/Swiss-Prot;Acc:Q1JQA5] |
| Percent Identity: | 64.49 % |
| Parental protein coverage: | 62.72 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GAGQAPR-PAERGPPVRLFTEEELARYGGEEEDQPIYMAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTR |
| G.GQA...P...GP...LF.EEELAR.GGEE.D.P.YMAVK.VVFDVTS.KE.YG.GA....LT.K.ST. | |
| Retrocopy | GPGQADATPYQLGPLMQLFIEEELARPGGEE-DLPEYMAVKAVVFDVTSRKELYGEGALSGVLTKKNSTT |
| Parental | GVAKMSLDPADLTHDTTGLTAEELESLDDVFTRVYKA |
| GV...SLDPAD.THDT.GL.A.ELE...D.FTRVY.A | |
| Retrocopy | GVTRLSLDPADFTHDTIGLMAQELEPPYDIFTRVYTA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .07 RPM | 8 .58 RPM |
| ERP005899_muscle | 0 .00 RPM | 54 .21 RPM |
| SRP017611_brain | 0 .14 RPM | 10 .55 RPM |
| SRP017611_kidney | 0 .00 RPM | 36 .93 RPM |
| SRP017611_liver | 0 .00 RPM | 13 .67 RPM |
| SRP030211_testis | 0 .22 RPM | 16 .97 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_379 |
| Pan troglodytes | retro_ptro_295 |
| Pongo abelii | retro_pabe_328 |
| Macaca mulatta | retro_mmul_490 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001341 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000000759 | 1 retrocopy |
retro_btau_1238 ,
|
| Dasypus novemcinctus | ENSDNOG00000003399 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031796 | 1 retrocopy | |
| Homo sapiens | ENSG00000117691 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025197 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002142 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000037499 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002893 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000014204 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000000236 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000001961 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015597 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000022293 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001880 | 3 retrocopies |