RetrogeneDB ID: | retro_ggor_321 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:172542207..172542552(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ITGB1BP1 | ||
| Ensembl ID: | ENSGGOG00000001754 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.26 % |
| Parental protein coverage: | 57.5 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | RHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLS |
| RH.SSSSQS.EISTKSKSVDSSLGGLS.SS.VASL.TDSTK.S..SNNNS.TCAEF.IKYVGAI..LKLS | |
| Retrocopy | RHRSSSSQSGEISTKSKSVDSSLGGLS*SSPVASLNTDSTKGSE*SNNNSNTCAEFQIKYVGAIKTLKLS |
| Parental | EGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVS |
| E...L.GPLDLINYIDVAQQD.KLP.VP.EE.FIMGVSKY..... | |
| Retrocopy | ERRCLKGPLDLINYIDVAQQDEKLPLVPLEEKFIMGVSKYNTSIN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 61 .62 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 29 .47 RPM |
| SRP007412_heart | 0 .00 RPM | 16 .64 RPM |
| SRP007412_kidney | 0 .00 RPM | 25 .60 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .34 RPM |
| SRP007412_testis | 0 .00 RPM | 15 .23 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_277 |
| Pan troglodytes | retro_ptro_231 |
| Pongo abelii | retro_pabe_391 |
| Macaca mulatta | retro_mmul_563 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000013063 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000013602 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006250 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008930 | 3 retrocopies | |
| Homo sapiens | ENSG00000119185 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001754 | 1 retrocopy |
retro_ggor_321 ,
|
| Macropus eugenii | ENSMEUG00000006761 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000002359 | 7 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010629 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000018036 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013322 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000003726 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001679 | 4 retrocopies | |
| Procavia capensis | ENSPCAG00000005976 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012667 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000011637 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000009799 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014537 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000859 | 1 retrocopy |