RetrogeneDB ID: | retro_ggor_278 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:113179826..113180000(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COA5 | ||
| Ensembl ID: | ENSGGOG00000006019 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.03 % |
| Parental protein coverage: | 78.38 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY |
| LKEDLG.CLLQS.CVVQEGKSP.QCLK.GYC..LKY.FFE.KRSVLD.R.R.RGRKGY | |
| Retrocopy | LKEDLGVCLLQSNCVVQEGKSPLQCLKKGYCKALKYSFFEYKRSVLDTRSRIRGRKGY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 31 .94 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 32 .90 RPM |
| SRP007412_heart | 0 .00 RPM | 8 .41 RPM |
| SRP007412_kidney | 0 .00 RPM | 32 .18 RPM |
| SRP007412_liver | 0 .00 RPM | 25 .64 RPM |
| SRP007412_testis | 0 .10 RPM | 35 .12 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_204 |
| Pan troglodytes | retro_ptro_340 |
| Pongo abelii | retro_pabe_435 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007139 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000009263 | 1 retrocopy | |
| Equus caballus | ENSECAG00000004183 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000013626 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004424 | 1 retrocopy | |
| Homo sapiens | ENSG00000183513 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006019 | 1 retrocopy |
retro_ggor_278 ,
|
| Myotis lucifugus | ENSMLUG00000013167 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000001197 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001998 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000002972 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000012085 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000012267 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000001578 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006275 | 1 retrocopy |