RetrogeneDB ID: | retro_ggor_230 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:28725834..28726050(+) | ||
| Located in intron of: | ENSGGOG00000006690 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TXNDC17 | ||
| Ensembl ID: | ENSGGOG00000003055 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 58.54 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFS |
| ....GLKH.SEGCVF.YCQV.EKPYWKDPNNDFRKNL.VT.VPTLLKYGTPQKLVES.CLQANLVEM.FS | |
| Retrocopy | MLNQGLKHVSEGCVFAYCQVEEKPYWKDPNNDFRKNLEVTTVPTLLKYGTPQKLVES*CLQANLVEMFFS |
| Parental | ED |
| .D | |
| Retrocopy | KD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .58 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 5 .48 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .94 RPM |
| SRP007412_kidney | 0 .08 RPM | 48 .98 RPM |
| SRP007412_liver | 0 .03 RPM | 26 .11 RPM |
| SRP007412_testis | 0 .00 RPM | 13 .68 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_132 |
| Pan troglodytes | retro_ptro_137 |
| Pongo abelii | retro_pabe_485 |
| Macaca mulatta | retro_mmul_365 |
| Callithrix jacchus | retro_cjac_2887 |