RetrogeneDB ID: | retro_fcat_459 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | A3:10296901..10297115(-) | ||
| Located in intron of: | ENSFCAG00000022069 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSFCAG00000024790 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
| Percent Identity: | 65.28 % |
| Parental protein coverage: | 86.59 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | GQAKKHPSLIPLFIFIGAGGTGAALYVLRLALFNPDVSWDRKNNPEPWNKLGPNDQYK-FYSVNVDYSKL |
| GQAKK...LIPL..F.GAGG..A.LYV..L.LFNPDVS.DR..NPEPW.K.GPN.QYK.F.SV...Y.KL | |
| Retrocopy | GQAKKPQNLIPLLAFTGAGGIRAVLYVSCLGLFNPDVSRDRRSNPEPWWKRGPNGQYK>FCSVTAHYCKL |
| Parental | KK |
| .K | |
| Retrocopy | EK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 125 .91 RPM |
| SRP017611_kidney | 0 .00 RPM | 136 .55 RPM |
| SRP017611_liver | 0 .00 RPM | 72 .68 RPM |