RetrogeneDB ID: | retro_fcat_1860 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | F2:66234474..66234872(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TSPAN3 | ||
| Ensembl ID: | ENSFCAG00000025746 | ||
| Aliases: | None | ||
| Description: | tetraspanin 3 [Source:HGNC Symbol;Acc:17752] |
| Percent Identity: | 72.59 % |
| Parental protein coverage: | 57.76 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | QKVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSC-CRETASSCNGSLAH |
| ..VYK.Y.GTNP...S.A...VQR.LH.CGIHNYSDW.N.D.FKETKNQSVPLSC.CRET.SS.NG.LAH | |
| Retrocopy | ESVYKAYSGTNPSDTSPAAHHVQR*LHSCGIHNYSDWDNPDRFKETKNQSVPLSC<CRETTSSSNG-LAH |
| Parental | PSDLYAEGCEALVVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRDPAYELLITGGTYA |
| .SDL.AEGCEALVVK.L.EIMM..IW...AFAAIQLLG.LCACI.LCR.SRDPA.E..ITG.T.A | |
| Retrocopy | RSDLHAEGCEALVVKELREIMMRIIWVVRAFAAIQLLGVLCACIRLCRTSRDPASEPSITGETSA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 213 .48 RPM |
| SRP017611_kidney | 0 .00 RPM | 149 .95 RPM |
| SRP017611_liver | 0 .00 RPM | 22 .85 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009727 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002415 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000018068 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000003785 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005619 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000010916 | 1 retrocopy | |
| Felis catus | ENSFCAG00000025746 | 1 retrocopy |
retro_fcat_1860 ,
|
| Mustela putorius furo | ENSMPUG00000017332 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000004662 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000005615 | 1 retrocopy |