RetrogeneDB ID: | retro_fcat_1850 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | F2:46304066..46304255(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37A | ||
| Ensembl ID: | ENSFCAG00000027010 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37a [Source:HGNC Symbol;Acc:10348] |
| Percent Identity: | 87.3 % |
| Parental protein coverage: | 68.48 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | EISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ |
| EISQHAKYTCSFCGKTKMKR.AVGIWHCG.CMKTV.GGAWTY...SAVTV.SAIRRLK.LKDQ | |
| Retrocopy | EISQHAKYTCSFCGKTKMKRQAVGIWHCGFCMKTVTGGAWTYIAISAVTVRSAIRRLKALKDQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 61 .17 RPM |
| SRP017611_kidney | 0 .00 RPM | 219 .82 RPM |
| SRP017611_liver | 0 .00 RPM | 103 .31 RPM |