RetrogeneDB ID: | retro_fcat_1250 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | C2:16992608..16992844(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC19 | ||
| Ensembl ID: | ENSFCAG00000010591 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528] |
| Percent Identity: | 65.06 % |
| Parental protein coverage: | 63.57 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | ASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSL-PKSAFSGGYYRGGFEPKMTKREAALILGIS |
| A.....VGLTIAAAGFAG.....A...M.PQVK.V.QSL..K..FSGGYYRGG..P.MTKREA.LILG.S | |
| Retrocopy | ATASTTVGLTIAAAGFAGGS-FNAPGNMAPQVKRVSQSL<TKPSFSGGYYRGGLNPPMTKREAVLILGVS |
| Parental | PTANKGKIRDAHR |
| P.AN.GK..DAHR | |
| Retrocopy | PIANRGK--DAHR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 13 .31 RPM |
| SRP017611_kidney | 0 .00 RPM | 20 .41 RPM |
| SRP017611_liver | 0 .00 RPM | 38 .52 RPM |