RetrogeneDB ID: | retro_eeur_204 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_207217:1744..1969(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PPIL1 | ||
| Ensembl ID: | ENSEEUG00000009371 | ||
| Aliases: | None | ||
| Description: | peptidylprolyl isomerase (cyclophilin)-like 1 [Source:HGNC Symbol;Acc:9260] |
| Percent Identity: | 96.0 % |
| Parental protein coverage: | 70.75 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | TKFHRIIKDFMIQGGDPTGTGRGGASLYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ |
| TKFHRIIKDFMIQGGDPTGTGRGGAS.YGKQFEDELHPDLKFTGA.ILAMANAGPDTNGSQFFVTLAP.Q | |
| Retrocopy | TKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGARILAMANAGPDTNGSQFFVTLAPIQ |
| Parental | WLDSK |
| WLDSK | |
| Retrocopy | WLDSK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 3 .22 RPM | 0 .64 RPM |
| SRP017611_kidney | 7 .13 RPM | 2 .06 RPM |
| SRP017611_liver | 1 .77 RPM | 0 .32 RPM |