RetrogeneDB ID: | retro_dnov_983 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_129734:1523..1673(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000004490 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.0 % |
| Parental protein coverage: | 54.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | GQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYM |
| G.GQK.QKV.VQPIN.IFRYLQNRS.IQVW...Q.NM..EG.II.F..Y. | |
| Retrocopy | GEGQKLQKVRVQPINRIFRYLQNRSQIQVWPSAQANM*LEGSIISFLFYL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 23 .92 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 12 .51 RPM |
| SRP012922_heart | 0 .00 RPM | 8 .59 RPM |
| SRP012922_kidney | 0 .00 RPM | 9 .31 RPM |
| SRP012922_liver | 0 .00 RPM | 7 .43 RPM |
| SRP012922_lung | 0 .00 RPM | 15 .27 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 8 .13 RPM |
| SRP012922_spleen | 0 .00 RPM | 24 .15 RPM |