RetrogeneDB ID: | retro_dnov_688 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_824:216920..217316(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V1E1 | ||
| Ensembl ID: | ENSDNOG00000014592 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 [Source:HGNC Symbol;Acc:857] |
| Percent Identity: | 74.63 % |
| Parental protein coverage: | 59.29 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | DLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIIRCRKQDFPLVKAAVQKAIPMYKIATKKE |
| DLLNE.K.RL.KV.K..TR...LLDGLVL.GL.QLLEPR..I.C.KQDFPLVKAAVQKAIPMYKIA.KK. | |
| Retrocopy | DLLNETK*RLGKVGKAATRD*LLLDGLVLYGLFQLLEPR--ICCKKQDFPLVKAAVQKAIPMYKIASKKD |
| Parental | VDVQIDQEAFLPEDVAGGVEIYSGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD |
| .DVQIDQEA.LPED.AGGVEI.SG...IKVS.TLES..DLI..Q.M.EV.GALF.AN.NRKFLD | |
| Retrocopy | IDVQIDQEASLPEDIAGGVEICSGKQTIKVSKTLESWVDLIH*QIMSEVLGALFDANSNRKFLD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 42 .20 RPM |
| SRP012922_cerebellum | 0 .41 RPM | 102 .41 RPM |
| SRP012922_heart | 0 .00 RPM | 23 .67 RPM |
| SRP012922_kidney | 0 .00 RPM | 58 .59 RPM |
| SRP012922_liver | 0 .00 RPM | 24 .00 RPM |
| SRP012922_lung | 0 .31 RPM | 34 .36 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 14 .54 RPM |
| SRP012922_spleen | 0 .11 RPM | 46 .59 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017489 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000016151 | 7 retrocopies | |
| Callithrix jacchus | ENSCJAG00000017277 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000014592 | 3 retrocopies |
retro_dnov_2037, retro_dnov_44, retro_dnov_688 ,
|
| Echinops telfairi | ENSETEG00000019283 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000003802 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014876 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000018452 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000018109 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006964 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000004591 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000016094 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011905 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000008300 | 2 retrocopies |