RetrogeneDB ID: | retro_dnov_2602 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_89389:790..1009(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | YWHAE | ||
| Ensembl ID: | ENSDNOG00000003808 | ||
| Aliases: | None | ||
| Description: | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide [Source:HGNC Symbol;Acc:12851] |
| Percent Identity: | 87.67 % |
| Parental protein coverage: | 55.73 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | EILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDXXXQNKEALQDVED |
| EIL.SPD.ACRLAKAAFDDAIAELDTLSE.SYKDSTLIM.L.RDNLTLWTSDMQGD...QNKE.LQDVED | |
| Retrocopy | EILKSPDHACRLAKAAFDDAIAELDTLSEGSYKDSTLIM*LFRDNLTLWTSDMQGDGEEQNKEVLQDVED |
| Parental | ENQ |
| ENQ | |
| Retrocopy | ENQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 84 .98 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 119 .87 RPM |
| SRP012922_heart | 0 .00 RPM | 57 .08 RPM |
| SRP012922_kidney | 0 .00 RPM | 72 .28 RPM |
| SRP012922_liver | 0 .00 RPM | 35 .30 RPM |
| SRP012922_lung | 0 .00 RPM | 62 .01 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 81 .87 RPM |
| SRP012922_spleen | 0 .00 RPM | 49 .68 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000010861 | 2 retrocopies | |
| Ciona intestinalis | ENSCING00000023856 | 1 retrocopy | |
| Ciona savignyi | ENSCSAVG00000011723 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000001672 | 10 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000003808 | 2 retrocopies |
retro_dnov_1452, retro_dnov_2602 ,
|
| Echinops telfairi | ENSETEG00000012056 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016840 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000014607 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007769 | 4 retrocopies |