RetrogeneDB ID: | retro_dnov_99 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_1584:52946..53280(+) | ||
| Located in intron of: | ENSDNOG00000003904 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | YWHAZ | ||
| Ensembl ID: | ENSDNOG00000001672 | ||
| Aliases: | None | ||
| Description: | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:HGNC Symbol;Acc:12855] |
| Percent Identity: | 66.07 % |
| Parental protein coverage: | 80.43 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | YRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTA |
| ...LAEVA.....K...D....AY.EAF.I.KKEMQPTHPI.LGLALNFS.FYYEILN.PE.AC.L.K.A | |
| Retrocopy | FYFLAEVACHNGRKQAIDNPRGAY*EAFDINKKEMQPTHPICLGLALNFSEFYYEILNNPELACTLTKMA |
| Parental | -FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDE |
| .FDEAIAEL.T....SYKD..LI.QLLRDNLTLWTSD....E | |
| Retrocopy | >FDEAIAELNTSNKDSYKDRALILQLLRDNLTLWTSDSAREE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .39 RPM | 62 .04 RPM |
| SRP012922_cerebellum | 0 .14 RPM | 53 .48 RPM |
| SRP012922_heart | 0 .00 RPM | 3 .94 RPM |
| SRP012922_kidney | 0 .00 RPM | 11 .50 RPM |
| SRP012922_liver | 0 .00 RPM | 8 .82 RPM |
| SRP012922_lung | 0 .15 RPM | 30 .39 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 3 .46 RPM |
| SRP012922_spleen | 0 .00 RPM | 44 .53 RPM |