RetrogeneDB ID: | retro_dnov_2364 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_67536:7988..8371(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNAP29 | ||
| Ensembl ID: | ENSDNOG00000005913 | ||
| Aliases: | None | ||
| Description: | synaptosomal-associated protein, 29kDa [Source:HGNC Symbol;Acc:11133] |
| Percent Identity: | 52.17 % |
| Parental protein coverage: | 53.39 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 4 |
| Parental | KKPVKKPPEQNGTLAPQTSSRLKEAITTSKEQES-KYQASHPNLRKLDNSDSIIGGASSAESAEAY-PKN |
| KK..K..P..N....PQ.SSR.....T........KYQASHPN..K.....SI..GASSA..AEAY.P.. | |
| Retrocopy | KKIKKLHPLYNSAPHPQ-SSRRMKDATIT*KEQE<KYQASHPNIIKC----SITEGASSAINAEAY<PMY |
| Parental | LHLRAYHQKIDSNLDELSL-GLGRLKD-IALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL |
| .HL.A..QKI.SN.DEL.L.G.G......ALGM..E..EQDDILD.....VD.LDV.IKSTERK..QL | |
| Retrocopy | SHL*ACVQKIHSNPDELFL<GIGQPEG<TALGM*MEVQEQDDILDLVIN*VDYLDVSIKSTERKSLQL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 10 .31 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 13 .20 RPM |
| SRP012922_heart | 0 .00 RPM | 2 .78 RPM |
| SRP012922_kidney | 0 .00 RPM | 4 .65 RPM |
| SRP012922_liver | 0 .00 RPM | 4 .02 RPM |
| SRP012922_lung | 0 .00 RPM | 4 .73 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1 .90 RPM |
| SRP012922_spleen | 0 .00 RPM | 6 .87 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000015201 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000003137 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000005913 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000108 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013003 | 1 retrocopy |