RetrogeneDB ID: | retro_dnov_164 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_2247:368427..368826(-) | ||
| Located in intron of: | ENSDNOG00000015107 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMBIM6 | ||
| Ensembl ID: | ENSDNOG00000007882 | ||
| Aliases: | None | ||
| Description: | transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:11723] |
| Percent Identity: | 79.7 % |
| Parental protein coverage: | 99.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GLGPALELCIAINPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSI |
| G.GPAL.L.IAIN.S.LPTAF.GTAM...CFTLS..Y.R..SYLFLGGILMS.M.L.LLSSLGNLFFGS. | |
| Retrocopy | GVGPALKLYIAINTSVLPTAFKGTAMVLPCFTLSVIYVRHCSYLFLGGILMSSMGLTLLSSLGNLFFGSL |
| Parental | WLFQANLYVGLVVMCGFVLFDTQLIIEKAENGDKDYIWHCVDLFLDFVTLFRKLMMILAMNEK |
| ..FQANLY.GLVVMCGFVLFDTQ.IIEKAENGDKDYI.HC.D.FLDFVTLFRKLMMILAM.E. | |
| Retrocopy | GVFQANLYIGLVVMCGFVLFDTQFIIEKAENGDKDYISHCIDHFLDFVTLFRKLMMILAMSEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 5 .06 RPM | 74 .48 RPM |
| SRP012922_cerebellum | 2 .20 RPM | 19 .38 RPM |
| SRP012922_heart | 1 .39 RPM | 15 .08 RPM |
| SRP012922_kidney | 10 .95 RPM | 126 .22 RPM |
| SRP012922_liver | 11 .15 RPM | 143 .97 RPM |
| SRP012922_lung | 2 .90 RPM | 56 .20 RPM |
| SRP012922_quadricep_muscle | 0 .69 RPM | 19 .21 RPM |
| SRP012922_spleen | 4 .01 RPM | 54 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000018588 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000008400 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000021032 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007882 | 2 retrocopies |
retro_dnov_164 , retro_dnov_857,
|
| Macropus eugenii | ENSMEUG00000015590 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000004277 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000005137 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000016821 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000010366 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001165 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002427 | 1 retrocopy |