RetrogeneDB ID: | retro_dnov_1395 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_19472:22625..22948(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAP1B | ||
| Ensembl ID: | ENSDNOG00000019724 | ||
| Aliases: | None | ||
| Description: | RAP1B, member of RAS oncogene family [Source:HGNC Symbol;Acc:9857] |
| Percent Identity: | 82.57 % |
| Parental protein coverage: | 69.03 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MREYKLVVLGSGG-VGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRD |
| MRE.KLVVLGSGG..GKSALTVQ.VQGIFVEKYDP.IEDSYR.QVEVD.QQ.M..ILD.AGTEQFT.MRD | |
| Retrocopy | MREHKLVVLGSGG<LGKSALTVQLVQGIFVEKYDPMIEDSYREQVEVDCQQRMFKILDIAGTEQFTVMRD |
| Parental | LYMKNGKGFALVYSITAQSTFNDLQDLREQIL-RKDTDD |
| LYMKNG.GFAL.YSITAQSTFN.LQDLR.QIL..KDT.D | |
| Retrocopy | LYMKNGQGFALLYSITAQSTFNGLQDLRRQIL*VKDTED |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .97 RPM | 6 .81 RPM |
| SRP012922_cerebellum | 0 .82 RPM | 1 .92 RPM |
| SRP012922_heart | 0 .23 RPM | 1 .16 RPM |
| SRP012922_kidney | 1 .10 RPM | 4 .38 RPM |
| SRP012922_liver | 0 .46 RPM | 4 .33 RPM |
| SRP012922_lung | 0 .61 RPM | 8 .25 RPM |
| SRP012922_quadricep_muscle | 0 .69 RPM | 1 .38 RPM |
| SRP012922_spleen | 1 .26 RPM | 15 .68 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008637 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000008272 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007809 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000015293 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000017413 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000019724 | 18 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000010052 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000242 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025649 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000016460 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013148 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011442 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000029552 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000005746 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000004751 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005197 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007048 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000021148 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030014 | 2 retrocopies |