RetrogeneDB ID: | retro_dnov_1233 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_16727:350..666(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPL27 | ||
| Ensembl ID: | ENSDNOG00000023845 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L27 [Source:HGNC Symbol;Acc:14483] |
| Percent Identity: | 62.04 % |
| Parental protein coverage: | 79.1 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | TTLLNPPQATALTVRYASKKTGGSSKNLGGKSPG-KRFGIKKMEGHYVHAGNILGTQRQFRWHPGAHVGL |
| TTLLN.PQA..L.VRY.SKK.G.SS.NL.GKSP..K..GI.K.EGH.VHAGN.LGTQRQ..W.PGAHVGL | |
| Retrocopy | TTLLNIPQAAGLAVRYTSKKAGCSSRNLTGKSPA<KHCGINKGEGHCVHAGNVLGTQRQAGWPPGAHVGL |
| Parental | GRRKCLYALEEGVVHYTKEVYVPSP-SNSEAMDLVTKL |
| G.R.C..AL....V.Y.K.V..P.P.....A.DLV.KL | |
| Retrocopy | GERRCPCALXXXXVRYAKKVCPPIP<TSCQAVDLVAKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 54 .84 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 47 .56 RPM |
| SRP012922_heart | 0 .00 RPM | 45 .94 RPM |
| SRP012922_kidney | 0 .00 RPM | 82 .69 RPM |
| SRP012922_liver | 0 .31 RPM | 44 .74 RPM |
| SRP012922_lung | 0 .15 RPM | 46 .89 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 45 .52 RPM |
| SRP012922_spleen | 0 .00 RPM | 47 .73 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000017031 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005103 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018851 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000023845 | 2 retrocopies |
retro_dnov_1233 , retro_dnov_1731,
|
| Erinaceus europaeus | ENSEEUG00000010549 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000014252 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000009698 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017231 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024414 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000004601 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000005385 | 1 retrocopy |