RetrogeneDB ID: | retro_cpor_1383 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_79:3671421..3671673(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ISCA1 | ||
| Ensembl ID: | ENSCPOG00000011872 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 52.94 % |
| Parental protein coverage: | 65.89 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLQDKPEHVGLKVGVRTRGCNGLSYTLEYTKTK |
| M..SLV..T....SKRK.Q...A.L.LT..A.N.IKQLL..K.E..G..V.V.TRGC..LS..L.Y.K.K | |
| Retrocopy | MLTSLVWVTL*VPSKRKPQSVGATLSLTLPAINRIKQLLKHKLELIGFIVDVQTRGCKVLSHILGYKKNK |
| Parental | GDSDEEVVQDGVRVF |
| GDSDE.VV.D..R.. | |
| Retrocopy | GDSDE-VV*DEIRMY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 50 .33 RPM |
| SRP017611_kidney | 0 .00 RPM | 69 .09 RPM |
| SRP017611_liver | 0 .00 RPM | 49 .40 RPM |
| SRP040447_lung | 0 .00 RPM | 29 .63 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 64 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046526 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001940 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000011872 | 2 retrocopies |
retro_cpor_1383 , retro_cpor_768,
|
| Dasypus novemcinctus | ENSDNOG00000010652 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000016537 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007518 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000003889 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003559 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044792 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015628 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000019339 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018343 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012826 | 2 retrocopies |