RetrogeneDB ID: | retro_cpor_1081 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_44:14049691..14050110(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAB14 | ||
| Ensembl ID: | ENSCPOG00000006688 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.68 % |
| Parental protein coverage: | 67.44 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | QERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNK-ADLEAQRDVTYEE |
| .E.FRAV.....RGAAG.....D.TR..T....SSW.TD.RN.T.P.T.......K.A....QRD.T..E | |
| Retrocopy | KE*FRAVPGNSCRGAAGTCVMWDATR--THGLGSSWVTDVRNPTSPKT-VTVLESK<AASKTQRDFTCGE |
| Parental | AKQFA-EENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSL-DLNAAESG-VQHKPSAPQGGRLTSE |
| ..QF..E.NG.L.L.A....GEN.EDAFLE.AKKI.QN.Q.GSL..L..AESG.VQH.PSAPQ.G..... | |
| Retrocopy | VMQFL<EDNGFLLLAADRRMGENAEDAFLEPAKKIPQNVQVGSL<ALTDAESG<VQHRPSAPQRGS*EMS |
| Parental | PQPQREGCG |
| ..P.R.GCG | |
| Retrocopy | SKP-RAGCG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 54 .24 RPM |
| SRP017611_kidney | 0 .00 RPM | 41 .25 RPM |
| SRP017611_liver | 0 .00 RPM | 55 .63 RPM |
| SRP040447_lung | 0 .00 RPM | 38 .97 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 17 .42 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000003669 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000006688 | 1 retrocopy |
retro_cpor_1081 ,
|
| Cavia porcellus | ENSCPOG00000026575 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009818 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013654 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012973 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000003919 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017800 | 1 retrocopy |