RetrogeneDB ID: | retro_cjac_2683 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:152299014..152299317(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ANAPC10 | ||
| Ensembl ID: | ENSCJAG00000002663 | ||
| Aliases: | None | ||
| Description: | anaphase promoting complex subunit 10 [Source:HGNC Symbol;Acc:24077] |
| Percent Identity: | 81.37 % |
| Parental protein coverage: | 55.14 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | TPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKT |
| T.P...P.....TG.V.EIGSQAVWSLSSCKPGFGVDQLRDDNLE.Y.Q.DGS..HLVNIQFRRKTTVKT | |
| Retrocopy | TTPNKTPPGADPTGAVQEIGSQAVWSLSSCKPGFGVDQLRDDNLEAY*Q*DGSL-HLVNIQFRRKTTVKT |
| Parental | LCIYADYKSDESYTPSKISVRVGNNFHNLQEI |
| LCIYADYKS.ESYTPSKISVRVGNN.HNL.EI | |
| Retrocopy | LCIYADYKSNESYTPSKISVRVGNNSHNLPEI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .11 RPM | 4 .59 RPM |
| SRP051959_heart | 0 .07 RPM | 3 .24 RPM |
| SRP051959_kidney | 0 .16 RPM | 5 .75 RPM |
| SRP051959_liver | 0 .45 RPM | 3 .21 RPM |
| SRP051959_lung | 0 .13 RPM | 5 .11 RPM |
| SRP051959_lymph_node | 0 .11 RPM | 5 .46 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 1 .70 RPM |
| SRP051959_spleen | 0 .25 RPM | 7 .69 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002663 | 2 retrocopies |
retro_cjac_2683 , retro_cjac_2999,
|
| Dipodomys ordii | ENSDORG00000016690 | 1 retrocopy | |
| Homo sapiens | ENSG00000164162 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025091 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000008607 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004432 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000036977 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005453 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006902 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000015096 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016480 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000013169 | 2 retrocopies |