RetrogeneDB ID: | retro_chof_72 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_1264:42777..43220(+) | ||
| Located in intron of: | ENSCHOG00000003744 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DSTN | ||
| Ensembl ID: | ENSCHOG00000003110 | ||
| Aliases: | None | ||
| Description: | destrin (actin depolymerizing factor) [Source:HGNC Symbol;Acc:15750] |
| Percent Identity: | 55.63 % |
| Parental protein coverage: | 91.41 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | ASVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKH-F |
| ..V.V..EV...F..MKVRK.ST.EEI.....A..FCLS.D...I...E.K.ILVGDVG.T..DP....F | |
| Retrocopy | SGVTVTNEVIKVFNNMKVRK-STQEEIXXXXXAILFCLSDDRRQITIVEVKQILVGDVGDTVEDPYTS>F |
| Parental | VGMLPEKDCRYALYDASFETKES-RKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGP |
| V..L...DC.YALY.A..ETKES..KE.L.F..WAP...PLKSKMIYA.SKDAIKKKF.GIKHE.Q.NG. | |
| Retrocopy | VKLLHLNDC*YALYSAKYETKES>KKEDLVFIFWAPQSVPLKSKMIYA-SKDAIKKKFTGIKHEWQVNGL |
| Parental | EDLNRACIAEK |
| .D.......E. | |
| Retrocopy | DDIKDCSTLER |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015434 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000003110 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000005573 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000934 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011893 | 1 retrocopy | |
| Homo sapiens | ENSG00000125868 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009007 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013687 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013786 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000015932 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009679 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027456 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000976 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000010727 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013275 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000000420 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005924 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007085 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000017634 | 8 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007291 | 1 retrocopy |