RetrogeneDB ID: | retro_cfam_557 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 13:51156007..51156237(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FIS1 | ||
| Ensembl ID: | ENSCAFG00000013800 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 56.63 % |
| Parental protein coverage: | 53.95 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | RDYVFYLAVGNYRLKEY-EKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGL |
| .D.VF.LAVG...LKEY....LKYVRGLL.T.P.N.QA.ELE.LI.KA..K...VG....G..A.G.AGL | |
| Retrocopy | KDLVFFLAVGSDLLKEY<QDTLKYVRGLL*TQPLNIQAEELEWLINKAVRKMETVGDMTLG--ARGLAGL |
| Parental | AGLIGLAVSKSKS |
| .GL...AVSK.K. | |
| Retrocopy | TGL---AVSKCKT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 64 .72 RPM |
| SRP017611_brain | 0 .00 RPM | 49 .78 RPM |
| SRP017611_kidney | 0 .00 RPM | 150 .76 RPM |
| SRP017611_liver | 0 .00 RPM | 39 .74 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000013800 | 2 retrocopies |
retro_cfam_557 , retro_cfam_755,
|
| Callithrix jacchus | ENSCJAG00000016053 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000020494 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000024207 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000005034 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028158 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000001420 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000027757 | 1 retrocopy |