RetrogeneDB ID: | retro_cfam_1150 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 24:32850654..32850990(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PARK7 | ||
| Ensembl ID: | ENSCAFG00000019674 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.71 % |
| Parental protein coverage: | 59.26 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | GAQNLCESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGSHYSYSENRVE |
| G.QN.CE.AA.KEI.KEQE.RKGLIAAICAGPTAL.AHEIGFGSKVTTHPLAKDKMMN.SHYSYSENR.. | |
| Retrocopy | GTQNVCEYAAEKEIMKEQEDRKGLIAAICAGPTALWAHEIGFGSKVTTHPLAKDKMMN*SHYSYSENRMA |
| Parental | KDGLILTSRGPGTSFEFALAIVEALSGKDVADQVKAPLVLKD |
| KDGL.LTSRGP.TSF.FALAIVEALSGK.V.DQVKA.LVLKD | |
| Retrocopy | KDGLVLTSRGPATSFAFALAIVEALSGKHVPDQVKATLVLKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 109 .36 RPM |
| SRP017611_brain | 0 .00 RPM | 101 .54 RPM |
| SRP017611_kidney | 0 .00 RPM | 623 .85 RPM |
| SRP017611_liver | 0 .00 RPM | 93 .03 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003703 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019674 | 1 retrocopy |
retro_cfam_1150 ,
|
| Choloepus hoffmanni | ENSCHOG00000004364 | 7 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000319 | 4 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000013141 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010915 | 1 retrocopy | |
| Homo sapiens | ENSG00000116288 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012105 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000008470 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008790 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016511 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000002151 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001925 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000000102 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018289 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000009474 | 13 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001455 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000011076 | 1 retrocopy |