RetrogeneDB ID: | retro_cfam_1030 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 21:12807604..12807962(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | VBP1 | ||
| Ensembl ID: | ENSCAFG00000019639 | ||
| Aliases: | None | ||
| Description: | von Hippel-Lindau binding protein 1 [Source:HGNC Symbol;Acc:12662] |
| Percent Identity: | 69.92 % |
| Parental protein coverage: | 59.9 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | EIKQTLEILKYMQKKKESTGSLETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDI-DEAQALLEKNL |
| E..Q..E......KK..S..SLETRFLLAD.LYCKASVPPTDKVCL.LGAN...EYD...EAQALLEKNL | |
| Retrocopy | EKRQVREATQHNEKKSPSVSSLETRFLLADTLYCKASVPPTDKVCL*LGANERPEYDL<EEAQALLEKNL |
| Parental | STATKNLDSLEEDLDFLR-DQFTTTEVNMARVYNWDVKRRNK---DDSTKNKA |
| .TATK.LDSL.E.LDF...DQFTTTEVNMA.VYNWDVK.R.....D.STKNKA | |
| Retrocopy | PTATKKLDSLAE-LDFFE<DQFTTTEVNMAMVYNWDVKERIRXXXDASTKNKA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 25 .41 RPM |
| SRP017611_brain | 0 .00 RPM | 23 .98 RPM |
| SRP017611_kidney | 0 .33 RPM | 31 .63 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .95 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009058 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000019639 | 2 retrocopies |
retro_cfam_1030 , retro_cfam_573,
|
| Cavia porcellus | ENSCPOG00000013652 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000019432 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000004628 | 2 retrocopies | |
| Latimeria chalumnae | ENSLACG00000016144 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015095 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031197 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014475 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017448 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016566 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000002823 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012811 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000006684 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000007833 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002205 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000016258 | 1 retrocopy |