RetrogeneDB ID: | retro_btau_838 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 2:119666467..119666810(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5G3 | ||
| Ensembl ID: | ENSBTAG00000002944 | ||
| Aliases: | None | ||
| Description: | ATP synthase lipid-binding protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q3ZC75] |
| Percent Identity: | 73.5 % |
| Parental protein coverage: | 80.85 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | AKLACTPAL-IRAGSRVAYRPISASVLSRPETRTGEGCTVFNGTQNGVSQLIQREF-QTTAVNRDIDTAA |
| ....C.PA....AGSRVA.RPISASVLSR...RT.EG..VF.G.QNGVSQLIQREF.QT.AV.RD..TAA | |
| Retrocopy | SQASCLPAPPLQAGSRVAGRPISASVLSRLKARTAEGSAVFSGAQNGVSQLIQREF<QTSAVSRDAETAA |
| Parental | KFIGA-GAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAIL |
| .FIGA...AT.GVAGS.AGIGTVFGSLII.YARNP.LKQQLFSYAIL | |
| Retrocopy | TFIGA<TCATTGVAGSSAGIGTVFGSLIIDYARNPFLKQQLFSYAIL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 56 .52 RPM | 60 .92 RPM |
| ERP005899_muscle | 3 .33 RPM | 231 .64 RPM |
| SRP017611_brain | 12 .52 RPM | 59 .57 RPM |
| SRP017611_kidney | 1 .07 RPM | 216 .34 RPM |
| SRP017611_liver | 29 .07 RPM | 51 .57 RPM |
| SRP030211_testis | 0 .51 RPM | 25 .89 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002944 | 1 retrocopy |
retro_btau_838 ,
|
| Bos taurus | ENSBTAG00000005735 | 11 retrocopies | |
| Bos taurus | ENSBTAG00000018339 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000013366 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000012592 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000008207 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000010440 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000010768 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012822 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003954 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000009520 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000012159 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000011524 | 3 retrocopies |