RetrogeneDB ID: | retro_amel_1421 | ||
Retrocopy location | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL193352.1:699351..699594(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSAMEG00000016604 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.14 % |
| Parental protein coverage: | 56.34 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | KLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ-FD |
| ...K.VW.NTSD.ILVGLRD.QDNKADV.LKYNADEA.SL.AYGELPE...I.ETDTFG.GD........ | |
| Retrocopy | EIEKIVWENTSDVILVGLRDDQDNKADVTLKYNADEAGSLRAYGELPERFRIIETDTFGLGDEF*FSLMS |
| Parental | DIGDDDEDIDD |
| .IGDDDEDI.D | |
| Retrocopy | SIGDDDEDISD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016604 | 1 retrocopy |
retro_amel_1421 ,
|
| Callithrix jacchus | ENSCJAG00000005371 | 1 retrocopy | |
| Homo sapiens | ENSG00000173674 | 2 retrocopies | |
| Latimeria chalumnae | ENSLACG00000015565 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000193 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000027820 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000067194 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008182 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022504 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005736 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029864 | 1 retrocopy |