RetrogeneDB ID: | retro_ttru_922 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | GeneScaffold_672:201469..201693(+) | ||
| Located in intron of: | ENSTTRG00000016706 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C19orf43 | ||
| Ensembl ID: | ENSTTRG00000005460 | ||
| Aliases: | None | ||
| Description: | chromosome 19 open reading frame 43 [Source:HGNC Symbol;Acc:28424] |
| Percent Identity: | 83.12 % |
| Parental protein coverage: | 75.76 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | GSEEEGRP-GPTLSFVGKRRGGNKLALKTGIVAKKQKTEDEVLTSKGDAWAKYMAEVKKYKA-HQCGDDD |
| GSEEEG.P.GPTLSF.GKR.GGNKLALKTG..AKK.KTE.EVLTSKGDAWAKYMAEVK.YKA.HQC.DDD | |
| Retrocopy | GSEEEGQP>GPTLSFMGKRTGGNKLALKTGTAAKK-KTENEVLTSKGDAWAKYMAEVKNYKA>HQCRDDD |
| Parental | KTRPLVK |
| .TRPL.K | |
| Retrocopy | ETRPLMK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Monodelphis domestica | ENSMODG00000025628 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000003863 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000005460 | 1 retrocopy |
retro_ttru_922 ,
|