RetrogeneDB ID: | retro_ttru_583 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | GeneScaffold_2755:537689..537913(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RBX1 | ||
| Ensembl ID: | ENSTTRG00000012018 | ||
| Aliases: | None | ||
| Description: | ring-box 1, E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:9928] |
| Percent Identity: | 81.58 % |
| Parental protein coverage: | 91.46 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | LWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCN-HAFHFHCISRWLKTRQVCPLDNRE |
| .WAWDIVVDNCA.CRNHIM.LCIECQANQASATSE.C.VAWGVCN...FHFH.ISR.L.T.QVC.LD.RE | |
| Retrocopy | IWAWDIVVDNCATCRNHIMVLCIECQANQASATSEQCAVAWGVCN<RSFHFHRISRGLRT*QVCLLDSRE |
| Parental | WEFQKY |
| WEFQKY | |
| Retrocopy | WEFQKY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |