RetrogeneDB ID: | retro_tsyr_1813 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_599573:253..475(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HSPB11 | ||
| Ensembl ID: | ENSTSYG00000012499 | ||
| Aliases: | None | ||
| Description: | heat shock protein family B (small), member 11 [Source:HGNC Symbol;Acc:25019] |
| Percent Identity: | 75.68 % |
| Parental protein coverage: | 51.75 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | RTLKIEKSTSKEPVDXXXXXXXXLVHTEGQLQNEEMVVRDGSATYLRFIIISAFDHFASVHSISAEGIVI |
| .TLK.EKSTSKEPVD........LVHTEGQLQNEE.VV.DGSATYLRFI.ISAFD.F.SVHS..AEG.VI | |
| Retrocopy | QTLKTEKSTSKEPVDFEQWIKKDLVHTEGQLQNEEIVVCDGSATYLRFIFISAFDNFVSVHSFYAEGTVI |
| Parental | SNLS |
| SNLS | |
| Retrocopy | SNLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000000284 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000010241 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000002643 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012499 | 2 retrocopies |
retro_tsyr_1813 , retro_tsyr_697,
|