RetrogeneDB ID: | retro_tsyr_1627 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_517651:276..467(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS18 | ||
| Ensembl ID: | ENSTSYG00000012508 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S18 [Source:HGNC Symbol;Acc:10401] |
| Percent Identity: | 56.92 % |
| Parental protein coverage: | 50.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | LNTNIDGRRKIAFAITAIK-GVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKI |
| LN..IDG...IA.AITAIK.GVG..Y..V.L.K.DIDL..R....TED.....ITIM.NP.QY.I | |
| Retrocopy | LNSGIDGWQQIALAITAIK<GVG*QYSLVPLKKIDIDLINRLEGFTEDGMVCGITIMSNPDQYGI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010356 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000032173 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012508 | 8 retrocopies |
retro_tsyr_1121, retro_tsyr_1307, retro_tsyr_1627 , retro_tsyr_194, retro_tsyr_1949, retro_tsyr_2042, retro_tsyr_575, retro_tsyr_639,
|