RetrogeneDB ID: | retro_tbel_695 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_2758:34261..34477(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTBEG00000008820 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.57 % |
| Parental protein coverage: | 65.77 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | VPGGVVLLENVRIFMNAHRNVLFYVVFLQRLSRALH-VLLHLFGHVRIFDHGLSVAHVSHRVRGWLTATV |
| VP.GVVLL..V........NVLFY..FLQ.LS.ALH.VLLHLF.HV.IFDHGLS.AH..H..RGWLTA.V | |
| Retrocopy | VPDGVVLL--VKLLLDMGHNVLFYIIFLQHLSCALH*VLLHLF*HVCIFDHGLSIAHGYHVNRGWLTAMV |
| Parental | SWGR |
| SWGR | |
| Retrocopy | SWGR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000009268 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008793 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000001195 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000005032 | 6 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008820 | 3 retrocopies |
retro_tbel_1196, retro_tbel_1765, retro_tbel_695 ,
|