RetrogeneDB ID: | retro_tbel_4675 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_9754:34748..34967(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DPY30 | ||
| Ensembl ID: | ENSTBEG00000017486 | ||
| Aliases: | None | ||
| Description: | dpy-30 homolog (C. elegans) [Source:HGNC Symbol;Acc:24590] |
| Percent Identity: | 68.92 % |
| Parental protein coverage: | 74.75 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | AENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKXXPPNPIEF |
| AE.PHSEYGLTDNVER.VENEKIN.EKSSKQKVDLQS.P.R..LDQT....L..G.....K..PPNP.E. | |
| Retrocopy | AEHPHSEYGLTDNVERRVENEKINTEKSSKQKVDLQSSPPRTDLDQTGA-YLTAGTYCPCKERPPNPMEV |
| Parental | LASY |
| LAS. | |
| Retrocopy | LASF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000007768 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000005708 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019630 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000012471 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006389 | 4 retrocopies | |
| Felis catus | ENSFCAG00000026246 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006193 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000015346 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000015481 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000005211 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024067 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017877 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000034197 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000011833 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000005599 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000027126 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013372 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000017486 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000146 | 1 retrocopy |