RetrogeneDB ID: | retro_tbel_2173 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_103463:45744..46164(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSTBEG00000010267 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | AP1S2 | ||
| Ensembl ID: | ENSTBEG00000008834 | ||
| Aliases: | None | ||
| Description: | adaptor-related protein complex 1, sigma 2 subunit [Source:HGNC Symbol;Acc:560] |
| Percent Identity: | 83.67 % |
| Parental protein coverage: | 88.75 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 5 |
| Parental | MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAI |
| .QFMLLFS.QGKL.LQKWYVPL........TRELVQTVLARKPKMCSFLEWRDLK.VYKRYASLYFCCAI | |
| Retrocopy | LQFMLLFSLQGKLLLQKWYVPLXXXXXXXXTRELVQTVLARKPKMCSFLEWRDLKTVYKRYASLYFCCAI |
| Parental | EDQDNELITLE-IIHRYVELLDKYFGSVCELDIIFN-FEKAYF-ILDEF-LLGGEVQETSKKNVLKAIEQ |
| .DQDNELITLE.IIHRYVELLDKYFGSVCE.DIIFN.FEKAYF.ILDEF.LLGGEVQETSKK..L...EQ | |
| Retrocopy | KDQDNELITLE<IIHRYVELLDKYFGSVCERDIIFN<FEKAYF>ILDEF<LLGGEVQETSKKMFL-SNEQ |
| Parental | -ADLLQE |
| .ADLLQE | |
| Retrocopy | <ADLLQE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000020420 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004393 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000013888 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017197 | 7 retrocopies | |
| Otolemur garnettii | ENSOGAG00000011342 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000000733 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000010218 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000000117 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000013119 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000012142 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000008517 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008834 | 2 retrocopies |
retro_tbel_2173 , retro_tbel_4575,
|
| Tarsius syrichta | ENSTSYG00000005290 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007642 | 1 retrocopy |