RetrogeneDB ID: | retro_tbel_2155 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_102709:6939..7270(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C11orf74 | ||
| Ensembl ID: | ENSTBEG00000004277 | ||
| Aliases: | None | ||
| Description: | chromosome 11 open reading frame 74 [Source:HGNC Symbol;Acc:25142] |
| Percent Identity: | 81.42 % |
| Parental protein coverage: | 50.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | HFLALEDLDMDSDEETKPQMKQDLLLPGEVEEEVSTFTPSCVLLVARPLSPEVKPKPTVKGTDTRDETLG |
| .FL.LED.DM.SDEETKPQM..DLLLPGEVEEEVSTF.PSC.LLV..PLSPEVKPK.TVKGTDT..ETL. | |
| Retrocopy | NFLDLEDVDMNSDEETKPQMSRDLLLPGEVEEEVSTFIPSCILLVTQPLSPEVKPKSTVKGTDTGEETLE |
| Parental | -DEVQPFSLDEEFDYDSVTLT-PKFPAAEMEMLRELSKQRREN |
| .DEVQPFSLDEEF.YDSVTLT.PKFPAAEME...ELSKQRR.N | |
| Retrocopy | <DEVQPFSLDEEFVYDSVTLT<PKFPAAEMEVVKELSKQRRKN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000010963 | 2 retrocopies | |
| Homo sapiens | ENSG00000166352 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004773 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003065 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000008620 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019838 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003347 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003514 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000004277 | 2 retrocopies |
retro_tbel_2155 , retro_tbel_2277,
|