RetrogeneDB ID: | retro_tbel_1528 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_5006:665380..665608(+) | ||
| Located in intron of: | ENSTBEG00000008892 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | COPRS | ||
| Ensembl ID: | ENSTBEG00000008542 | ||
| Aliases: | None | ||
| Description: | coordinator of PRMT5, differentiation stimulator [Source:HGNC Symbol;Acc:28848] |
| Percent Identity: | 76.92 % |
| Parental protein coverage: | 59.54 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | LAAGDHSGQEGETEKAMDRLGKTSGAQSIANDSPAHGEGTRSEEEGFAVDEEESDGEPDTWELSEGTHCP |
| L..GDH.GQEGETE.AMD.L...SG.QSI.NDSPAHGEG..SEEEG.AVD.E.SDGEPDT.ELS.GTHCP | |
| Retrocopy | LPTGDHTGQEGETERAMD*LA--SGTQSITNDSPAHGEGSHSEEEGSAVDDEDSDGEPDT*ELSKGTHCP |
| Parental | PREQTGDL |
| P.EQTGDL | |
| Retrocopy | PKEQTGDL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000001885 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014110 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016418 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000008153 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000111 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008542 | 1 retrocopy |
retro_tbel_1528 ,
|
| Tursiops truncatus | ENSTTRG00000009909 | 1 retrocopy |