RetrogeneDB ID: | retro_sscr_815 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 5:43502906..43503076(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000023015 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 52.54 % |
| Parental protein coverage: | 80.56 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | GVYQCSQATRVRVRRGPAVSTSSPGHLVPGPRAPR-GRPALPWDSGPGLRACGVDQLSR |
| GVYQ.S..T...VR...A.ST..PG....G...PR.GR.AL...S.PGLR...VDQLSR | |
| Retrocopy | GVYQLSRQTQSQVR-ADAGSTTYPGQIGLGSKVPR<GRSALQANSEPGLRRHVVDQLSR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 0 .00 RPM |
| SRP014902_testis | 0 .00 RPM | 0 .00 RPM |
| SRP018288_heart | 0 .00 RPM | 0 .00 RPM |
| SRP018288_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP018288_liver | 0 .00 RPM | 0 .00 RPM |
| SRP018288_lung | 0 .00 RPM | 0 .00 RPM |
| SRP018856_adipose | 0 .00 RPM | 0 .00 RPM |
| SRP035408_brain | 0 .00 RPM | 0 .00 RPM |
| SRP035408_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Sus scrofa | ENSSSCG00000023015 | 6 retrocopies | |
| Sus scrofa | ENSSSCG00000023484 | 7 retrocopies | |
| Sus scrofa | ENSSSCG00000024741 | 1 retrocopy |