RetrogeneDB ID: | retro_sscr_746 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 4:623402..623723(+) | ||
| Located in intron of: | ENSSSCG00000005917 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000009907 | ||
| Aliases: | None | ||
| Description: | Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial [Source:UniProtKB/TrEMBL;Acc:F1RJI9] |
| Percent Identity: | 59.81 % |
| Parental protein coverage: | 78.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MWARAVWLGLRASAGAFRGFTSKADLQGSGRITAELVEHLERLALVDFGNQEAVARLEKAIAFADRLRDV |
| MWARAV.LGL.A.A.....FTSKAD..G.G.ITA.L.E...RLAL.D.G..EAVA.L.KA.AFA.....V | |
| Retrocopy | MWARAVCLGLLALAAGCGSFTSKADPRGRGQITAGLMERPRRLALGDSGSPEAVACLQKAMAFARWPCTV |
| Parental | DTDGVEPMDSVLEDRCLYLRSDNVVEGNCAEELLQNS |
| ..DGVEP..SVL.DRC..L..DN..EG.CAEELL..S | |
| Retrocopy | ALDGVEPTESVLADRCVPLSRDNGAEGSCAEELLRSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .13 RPM | 8 .10 RPM |
| SRP014902_testis | 0 .28 RPM | 26 .03 RPM |
| SRP018288_heart | 0 .13 RPM | 8 .46 RPM |
| SRP018288_kidney | 0 .20 RPM | 16 .06 RPM |
| SRP018288_liver | 0 .00 RPM | 8 .00 RPM |
| SRP018288_lung | 0 .20 RPM | 11 .91 RPM |
| SRP018856_adipose | 0 .00 RPM | 16 .19 RPM |
| SRP035408_brain | 0 .00 RPM | 9 .15 RPM |
| SRP035408_liver | 0 .06 RPM | 8 .98 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013298 | 1 retrocopy | |
| Equus caballus | ENSECAG00000011118 | 1 retrocopy | |
| Felis catus | ENSFCAG00000024015 | 1 retrocopy | |
| Homo sapiens | ENSG00000257218 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015651 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009867 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000004226 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005030 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005534 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009907 | 1 retrocopy |
retro_sscr_746 ,
|
| Tarsius syrichta | ENSTSYG00000006845 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000144 | 1 retrocopy |