RetrogeneDB ID: | retro_sscr_717 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 3:116441577..116441954(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS25 | ||
| Ensembl ID: | ENSSSCG00000015103 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S25 [Source:HGNC Symbol;Acc:10413] |
| Percent Identity: | 87.4 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | QPPK-DDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCK-EVPNYKLI |
| .PPK...KKKKDAGKSAKKDKDPVNKSGGKA.KKKWSKGKV.DKLNNLV.FDKATYDKL.K.EVPNYKLI | |
| Retrocopy | KPPKIKKKKKKDAGKSAKKDKDPVNKSGGKAQKKKWSKGKVWDKLNNLVSFDKATYDKLYK<EVPNYKLI |
| Parental | TPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA |
| .PA..SERLKIRGSLARAALQ.LLSKGLIKLVSKHRAQVIYT.NTKG.DAPAAGE.A | |
| Retrocopy | IPAIISERLKIRGSLARAALQKLLSKGLIKLVSKHRAQVIYT*NTKGRDAPAAGEHA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .13 RPM | 132 .07 RPM |
| SRP014902_testis | 0 .14 RPM | 197 .60 RPM |
| SRP018288_heart | 0 .18 RPM | 362 .18 RPM |
| SRP018288_kidney | 0 .49 RPM | 263 .80 RPM |
| SRP018288_liver | 0 .80 RPM | 277 .28 RPM |
| SRP018288_lung | 0 .00 RPM | 251 .21 RPM |
| SRP018856_adipose | 0 .18 RPM | 387 .94 RPM |
| SRP035408_brain | 0 .16 RPM | 195 .36 RPM |
| SRP035408_liver | 0 .06 RPM | 201 .79 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000051 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000012395 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000013298 | 2 retrocopies | |
| Felis catus | ENSFCAG00000001151 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000017117 | 6 retrocopies | |
| Microcebus murinus | ENSMICG00000002687 | 8 retrocopies | |
| Myotis lucifugus | ENSMLUG00000004752 | 15 retrocopies | |
| Monodelphis domestica | ENSMODG00000013334 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000004960 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000015103 | 12 retrocopies |