RetrogeneDB ID: | retro_sscr_446 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 14:101179128..101179297(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SVIP | ||
| Ensembl ID: | ENSSSCG00000022838 | ||
| Aliases: | None | ||
| Description: | small VCP/p97-interacting protein [Source:HGNC Symbol;Acc:25238] |
| Percent Identity: | 70.18 % |
| Parental protein coverage: | 72.73 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | GLCFPCPTEEAPPSPDPEEKRAKLAEAAERRQKEAASRGILDVRSVEEK-RKKKEKI |
| GL.F.CP.E.A.PS.D.E.KRAKLAEAAERRQ..A.S.GILDV.SVE...RKKKEK. | |
| Retrocopy | GLYFSCPMEVASPSLDLE*KRAKLAEAAERRQNNATSQGILDVPSVEGR>RKKKEKM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 0 .27 RPM |
| SRP014902_testis | 0 .00 RPM | 0 .71 RPM |
| SRP018288_heart | 0 .00 RPM | 2 .54 RPM |
| SRP018288_kidney | 0 .00 RPM | 5 .32 RPM |
| SRP018288_liver | 0 .00 RPM | 1 .76 RPM |
| SRP018288_lung | 0 .00 RPM | 2 .44 RPM |
| SRP018856_adipose | 0 .00 RPM | 0 .80 RPM |
| SRP035408_brain | 0 .00 RPM | 13 .69 RPM |
| SRP035408_liver | 0 .00 RPM | 2 .67 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013152 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000016735 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000022838 | 1 retrocopy |
retro_sscr_446 ,
|