RetrogeneDB ID: | retro_sscr_104 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:35412722..35413174(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSSSCG00000004197 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000014125 | ||
| Aliases: | None | ||
| Description: | Sus scrofa dihydrofolate reductase (DHFR), mRNA. [Source:RefSeq mRNA;Acc:NM_001244064] |
| Percent Identity: | 90.13 % |
| Parental protein coverage: | 80.65 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEYK-YQRMTTTSSVEGKQNLVIMGRKTWF-SIPEKNRPLK |
| MVRPLNCIVAV.QNMG.GKN.DLPWPPLRN.YK..QRMTTTSSVEGKQNLV.MGRKTWF.SIPEKN.PLK | |
| Retrocopy | MVRPLNCIVAVPQNMGFGKNEDLPWPPLRNDYKCFQRMTTTSSVEGKQNLVTMGRKTWF<SIPEKN*PLK |
| Parental | DRINIVLSRELKEPPQGAHFLAKSLDDALKLTEQPELKNKVDMVWIVGGSSVYKEAMNKPGHIRLFVTRI |
| DRIN.VLSRELKEPPQGAHFLAKSLDDALKLTE.PELKNKVDMVW.VGGSSVYKEAMNKPGH.RLFVTRI | |
| Retrocopy | DRINTVLSRELKEPPQGAHFLAKSLDDALKLTEKPELKNKVDMVWLVGGSSVYKEAMNKPGHLRLFVTRI |
| Parental | MKEFESDTFFPE |
| MKEFESDTFF.. | |
| Retrocopy | MKEFESDTFFSQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 1 .86 RPM |
| SRP014902_testis | 0 .00 RPM | 7 .50 RPM |
| SRP018288_heart | 0 .00 RPM | 7 .02 RPM |
| SRP018288_kidney | 0 .00 RPM | 21 .08 RPM |
| SRP018288_liver | 0 .00 RPM | 31 .82 RPM |
| SRP018288_lung | 0 .00 RPM | 14 .66 RPM |
| SRP018856_adipose | 0 .00 RPM | 4 .45 RPM |
| SRP035408_brain | 0 .00 RPM | 6 .29 RPM |
| SRP035408_liver | 0 .00 RPM | 20 .55 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015750 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000007681 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019556 | 4 retrocopies | |
| Equus caballus | ENSECAG00000026827 | 1 retrocopy | |
| Felis catus | ENSFCAG00000026745 | 3 retrocopies | |
| Homo sapiens | ENSG00000228716 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022366 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012200 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000018283 | 13 retrocopies | |
| Monodelphis domestica | ENSMODG00000024860 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008704 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021707 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012989 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000005127 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000025320 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015600 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000017042 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000013521 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000014125 | 2 retrocopies |
retro_sscr_104 , retro_sscr_1131,
|