RetrogeneDB ID: | retro_slyc_57 | ||
Retrocopylocation | Organism: | Tomato (Solanum lycopersicum) | |
| Coordinates: | 10:9816572..9816806(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | Solyc06g007470.2 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.64 % |
| Parental protein coverage: | 61.42 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | VRDVQEACAFELYTLPKLYLKMQYCVSCAIHSKVVRVRSRTDRRVREPPQRFRRPRDDLPKTGQAPRPAG |
| .RDV.....FEL.TLPKL.LKM.YCVSCAIHSKV.RV.S.TDRRV.EPPQ.FR.PRDDLPK.G.APRP.G | |
| Retrocopy | IRDV*VGFSFELDTLPKLNLKM*YCVSCAIHSKVIRVHSCTDRRVCEPPQHFRHPRDDLPKIG*APRPTG |
| Parental | GPPAAPRT |
| GPPAAPR. | |
| Retrocopy | GPPAAPRS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Brassica oleracea | Bo8g090770 | 1 retrocopy | |
| Solanum tuberosum | PGSC0003DMG400020566 | 2 retrocopies | |
| Solanum lycopersicum | Solyc06g007470.2 | 1 retrocopy |
retro_slyc_57 ,
|